SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3Q6Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q6Q6
Domain Number 1 Region: 5-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-67
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 528-648
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-24
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 3 Region: 241-359
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-23
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 4 Region: 384-451
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000000144
Family Pyk2-associated protein beta ARF-GAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Q6Q6
Sequence length 696
Comment (tr|G3Q6Q6|G3Q6Q6_GASAC) ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 {ECO:0000313|Ensembl:ENSGACP00000025566} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
EMTVKLDFEECLKDSPRFRADIELVQSDVSELETRLEKLVKQCQAMLEAGRVYCHTSKSF
VSGLRDLGQHCSGDKTMEECLDKFSKKLSIILDAQGEVIETTQKSVKTKLQNFVKEDVRR
FKDVRKEFERSSECLEGALVRNAQAPRSKQHEVEEASNALLNARRAFRSEAMDYVLEINV
IEAKKKTDILMAMLSLMESQAQLFQHGHQSLSELDEYRRKLNEEHTQFVLNSAREKRDME
QRHAAIKKKDVSYDDSIMDFNADAANGIPMEGYLYKRASNAFKTWSRRWFSIQKNQLVYQ
KKFKEQPTVVVEDLRLCTVKPSTENERRFCFEVVSPSNVGYWQAESEREQQAWIRCXQAL
IHTQTRGFNGLLNFNRSPESPFLPKVRSLTLDSWEPELIKLMCELGNTVINRIYEARIDE
ITIKKPHPSSPRGDKESWIRSKYVEKKFIQKLPETGRTALVRRSSGRRNRADAQDRPAQR
PPLKPKPGRATLPRLTGLNPSDLLQKNNTHRDSDEEEEDLSGLHPGALLYRSAALQNFPV
MADALAHGASVNWVNAAEESSTPLIQAVSANALAACEFLLQNGANVNQADSSGRGPLHHA
TILGHTGLVCLFLKRGADYNAKDKNQKDPITIAVDTANADIVTLLRIAKMNKEMREMDGA
FGQSGDETYHDIFRDFSHMASNNPEKLKRRSADPKT
Download sequence
Identical sequences G3Q6Q6
ENSGACP00000025566 ENSGACP00000025566 69293.ENSGACP00000025566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]