SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3Q8U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q8U6
Domain Number 1 Region: 125-245
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-33
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 2 Region: 2-35
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000694
Family Spectrin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3Q8U6
Sequence length 299
Comment (tr|G3Q8U6|G3Q8U6_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000026310} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGQSVDDVEKLIKRHEAFEKSAATWEERFSALERLTTLELLEVRRLQEEEERMRRPPSPE
PVVVLEEEPQQHSGLITQNGLPSDQDSPRDGGEKGDLLNGVCERSSKEPSPGTSPTSGRK
SKTSQSSTLPPKDQDPRPQLEGLLHRKHEWEAPNKKASNRSWHHVFCVITNHELGFYKDS
KAATQGAHYHSQAPVSLREASCDVASEYKKKKHVFKLRATDGNEFLFQAKDEEEMSTWIQ
AILNAGGDRPDPAGSGPGTPASGRAQTLPAGGDSSPGKREKDKDKDKEKRFSLFSKKKA
Download sequence
Identical sequences G3Q8U6
ENSGACP00000026310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]