SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3Q967 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q967
Domain Number 1 Region: 87-181
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-29
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 1.29e-21
Family L27 domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3Q967
Sequence length 217
Comment (tr|G3Q967|G3Q967_GASAC) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MATVVQPLSLDRDVARAIELLEKLQESGGVPGHKLQSLKKVLQSEFCTAIREVYQYMHET
ITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEE
MEARFEKLRTARRRQQQQILMQQQQLQNVASQQNHMS
Download sequence
Identical sequences G3Q967
69293.ENSGACP00000026431 ENSGACP00000026431 ENSGACP00000026431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]