SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QIW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QIW0
Domain Number 1 Region: 153-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.21e-69
Family Papain-like 0.000013
Further Details:      
 
Weak hits

Sequence:  G3QIW0
Domain Number - Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.000136
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 75-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000432
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QIW0
Sequence length 476
Comment (tr|G3QIW0|G3QIW0_GORGO) Tubulointerstitial nephritis antigen {ECO:0000313|Ensembl:ENSGGOP00000002331} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TINAG OC=Catarrhini; Hominidae; Gorilla.
Sequence
MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNF
GCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGC
FKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRPQLIEQVNKGDYGWTAQNYSQFW
GMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSN
ETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP
Download sequence
Identical sequences G3QIW0
XP_004044272.1.27298 ENSGGOP00000002331 ENSGGOP00000002331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]