SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QJX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJX6
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 2 Region: 102-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000023
Family Fibronectin type I module 0.044
Further Details:      
 
Domain Number 3 Region: 206-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QJX6
Sequence length 357
Comment (tr|G3QJX6|G3QJX6_GORGO) Nephroblastoma overexpressed {ECO:0000313|Ensembl:ENSGGOP00000002735} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NOV OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGQCPATPPTCAPGVRAVLDG
CSCCLVCARQRGENCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Download sequence
Identical sequences G3QJX6
XP_004047514.1.27298 ENSGGOP00000002735 ENSGGOP00000002735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]