SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QK24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QK24
Domain Number 1 Region: 24-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 202-300
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QK24
Sequence length 358
Comment (tr|G3QK24|G3QK24_GORGO) Ganglioside induced differentiation associated protein 1 {ECO:0000313|Ensembl:ENSGGOP00000002787} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GDAP1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL
SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR
VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD
LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC
GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL
ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Download sequence
Identical sequences G3QK24 Q8TB36
NP_061845.2.87134 NP_061845.2.92137 XP_004047211.1.27298 gi|108773797|ref|NP_061845.2| ENSP00000220822 ENSP00000220822 HR6766 ENSGGOP00000002787 ENSGGOP00000002787 ENSP00000220822 9606.ENSP00000220822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]