SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QLT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QLT3
Domain Number 1 Region: 26-231
Classification Level Classification E-value
Superfamily L domain-like 6.38e-42
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 1850-1943
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 2354-2438
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1946-2045
Classification Level Classification E-value
Superfamily Immunoglobulin 5.45e-20
Family I set domains 0.038
Further Details:      
 
Domain Number 5 Region: 2043-2137
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 2729-2825
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 2538-2631
Classification Level Classification E-value
Superfamily Immunoglobulin 6.45e-18
Family I set domains 0.036
Further Details:      
 
Domain Number 8 Region: 2145-2240
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-16
Family I set domains 0.03
Further Details:      
 
Domain Number 9 Region: 590-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000136
Family I set domains 0.02
Further Details:      
 
Domain Number 10 Region: 2249-2345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.059
Further Details:      
 
Domain Number 11 Region: 487-575
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000107
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 12 Region: 2454-2533
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000528
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 
Domain Number 13 Region: 2644-2730
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000926
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QLT3
Sequence length 2826
Comment (tr|G3QLT3|G3QLT3_GORGO) Matrix remodeling associated 5 {ECO:0000313|Ensembl:ENSGGOP00000003450} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MXRA5 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPKRAHWGALSVVLILLWGHPRVALACPHPCACYVPSEVHCTFRSLASVPAGIAKHVERI
NLGFNSIQALSETSFAGLTKLELLMIHGNEIPSIPDGALRDLSSLQVFKFSYNKLRVITG
QTLQGLSNLMRLHIDHNKIEFIHPQAFNGLTSLRLLHLEGNLLHQLHPSTFSTFTFLDYF
RLSTIRHLYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCDCEMRWFLEWDAKSRGILK
CKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDMTCLKPSIESPLRQNRSRSIEEEQEQEE
DGDSQLILEKFQLPQWSISLNMTDEHGNMVNLVCDIKKPMDVYKIHLNQTDPPDIDINAT
VALDFECPMIRENYEKLWKLIAYYSEVPVKLHRELMLSKDSRVSYQYRQDADEEALYYTG
VRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIE
PSGAVQRDQTVLEGGPCQLSCNVKASESPSIFWVLPDGSILKAPMDDPDSKFSILSSGWL
RIKSMEPSDSGLYQCIAQVRDEMDRMVYRVLVQSPSTQPTEKDTVTIGKNPGESVMLPCN
ALAVPEAHLSWILPNRRIINDLANTSHVYILPNGTLSIPKVQVSDSGYYRCVAVNQQGAD
HFTVGITVTKKGSGLPSKRDRRPGAKALSRVREDIVEDEGGSGMGDEENTSRRLLHPKDQ
EVFLKTKDDAISGDKKAKKGRRKLKLWKHSEKEPETNVAEGRRVFESRRRINMANKQINP
ERWADILAKVRGKNLPKGTEVPPLIKTTSPPSSSLEVTPPFSAVSPPSASPVQTVTSAEE
SSADVPLLGEEEHVLGTISSASMGLEHNHNGVILVEPEVTSTPLEEVVDDLSEKTEEITS
TEGDLKGTAAPTLISEPYEPSPTLHTLDTVYEKPTHEETATEGWSAADVGSSPEPTSSEY
EPPLDAVSLSEPVQYFDPDLETKSQPDEDKMKEDTFAHLTPTPTIWVNDFGTSQLFEDST
IGEPGVPGQSHLQGLTDNIHLVKSSLSTQDTLLIKKGMKEMSQTLQGGNMLEGDPTHSRS
SESEGQESKSITLPDSTPGIMSSMSPVKKPAETTVGTLLDKDTTTATTTPRQKVAPSSTM
STHPSRRRPNGRRRLRPNKFRHRHKQTPPTTFAPSETFSTQPTQAPDIKISSQVESSLVP
TAWVDNTVNTPQQLEMEKNAEPTSKGTPRRKHGKRPNKHRYTPSTVSSRASGSKPSPSPE
NKHRNIVTPSSETILLPRTVSLKTEGPYDSLDYMTTTRKIYSSYPKVQETLPVTYKPTSD
GKEIKDDVATNVDKHKSDILVTGESITNVIPTSRSLVSTMGEFKEESSPVGFPGTPTWNP
SRTAQPGRLQTDIPVTTSGENLTDPPLLKELEDVDFTSEFSSSVTVSTPFHQEEAGSSTT
LSSIKVEVASSQAETTTLDQDHHETTVAILLSETRPQNHTPTAARMKEPASSSPSTILMS
LGQTTTTKPALPSPRISQASRDSKENVFLNYVGNPETEATPVNNEGTQHMSGPNELSTPS
SDQDAFNLSTKLELEKQVFDSRSLPRGPDSHHQDGRVHASHQLTRVPAKPILPTATVRLP
EMSTQSTSRYFVSSQSPRHWTNKPEITTYPSRALPENKQFTTPRLSSTTTPLPLHMSKPS
IPSKFTDGRTDQFNGYSKVFGNNNIPEARNPVGKPPSPRIPHYSNGRLPFFTNKTLSFPQ
LGVTRRPQIPTSPAPVMRERKVIPGSYNRIHSHSTFHLDFGPPAPPLLHTPQTTGSPSTN
LQNIPMVSSTQSSVSFITSSVQSSGSFHQSSSKFFAGGPPASKFWSLGEKPQILTKSPQT
VSVTAETDTVFPCEATGKPKPFVTWTKVSTGALMTPNTRIQRFEVLKNGTLVIRKVQVQD
RGQYMCTASNLHGLDRMVVLLSVTVQQPQILASHYQDVTVYLGDTIAMECLAKGTPAPQI
SWIFPDRRVWQTVSPVEGRITLHENRTLSIKEASFSDRGVYKCVASNAAGADSLAIRLHV
AALPPVIHQEKLENISLPPGLSIHIHCTAKAAPLPSVRWVLGDGTQIRPSQFLHGNLFVF
PNGTLYIRNLAPKDSGRYECVAANLVGSARRMVQLNVQRAAANARITGTSPRRTDVRYGG
TLKLDCSASGDPWPRILWRLPSKRMIDALFSFDSRIKVFANGTLVVKSVTDKDAGDYLCI
ARNKVGDDYVVLKVDVVMKPAKIEHKEENDHKVFYGGDLKVDCVATGLPNPEISWSLPDG
SLVNSFMQSDDSGGRTKRYVVFNNGTLYFNEVGMREEGDYTCFAENQVGKDEMRVRVKVV
TAPATIRNKTYLAVQVPYGDVVTVACEAKGEPMPKVTWLSPTNKVIPTSSEKYQIYQDGT
LLIQKAQRSDSGNYTCLVRNSAGEDRKTVWIHVNVQPPKINGNPNPITTVREIAAGGSRK
LIDCKAEGIPTPRVLWAFPEGVVLPAPYYGNRVTVHGNGSLDIRSLRKSDSVQLVCMARN
EGGEARLIVQLTVLEPMEKPIFHDPISEKITAMAGHTISLNCSAAGTPTPSLVWVLPNGT
DLQSGQQLQRFYHKADGMLHISGLSSVDAGAYRCVAHNAAGHTERLVSLKVGLKPEANKQ
YHNLVSIINGETLKLPCTPPGAGQGRFSWTLPNGMHLEGPQTLGRISLLDNGTLTVREAS
VFDRGTYVCRMETEYGPSVTSIPVIVIAYPPRITSEPTPVIYTRPGNTVKLNCMAMGIPK
ADITWELPDKSHLKAGVQARLYGNRFLHPQGSLTIQHATQRDAGFYKCMAKNILGSDSKT
TYIHVF
Download sequence
Identical sequences G3QLT3
ENSGGOP00000003450 ENSGGOP00000003450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]