SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QQZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QQZ6
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-28
Family Kringle modules 0.00085
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QQZ6
Sequence length 462
Comment (tr|G3QQZ6|G3QQZ6_GORGO) Kringle containing transmembrane protein 2 {ECO:0000313|Ensembl:ENSGGOP00000005026} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=KREMEN2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG
TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPRA
PPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAPGKGPPALGPSRGPRRSWAVWY
RQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences G3QQZ6
XP_004057086.1.27298 ENSGGOP00000005026 ENSGGOP00000019280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]