SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QR65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QR65
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QR65
Sequence length 263
Comment (tr|G3QR65|G3QR65_GORGO) Phosphoinositide-3-kinase interacting protein 1 {ECO:0000313|Ensembl:ENSGGOP00000005102} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PIK3IP1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIEEAS
EGPGVDEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQDGSTPLMGQAGTPGA
Download sequence
Identical sequences G3QR65
XP_004063377.1.27298 ENSGGOP00000005102 ENSGGOP00000005102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]