SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QSN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QSN0
Domain Number 1 Region: 24-149
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-19
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 141-239
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-18
Family I set domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QSN0
Sequence length 327
Comment (tr|G3QSN0|G3QSN0_GORGO) V-set and immunoglobulin domain containing 2 {ECO:0000313|Ensembl:ENSGGOP00000005672} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=VSIG2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWS
FVQPGKPISESHPILYFTSGHLYPTGSKSKRVSLLQNPPTGGVATLKLTDVHPSDTGTYL
CQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWV
RLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQG
RVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGGSDLREDAIAPGISEHTCMRA
DSSKGFLERPSSASTVTTTKSKLPMVV
Download sequence
Identical sequences G3QSN0
ENSGGOP00000005672 ENSGGOP00000005672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]