SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QU65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QU65
Domain Number 1 Region: 39-382
Classification Level Classification E-value
Superfamily L domain-like 1.28e-64
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 425-514
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-17
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  G3QU65
Domain Number - Region: 530-615
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00254
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QU65
Sequence length 713
Comment (tr|G3QU65|G3QU65_GORGO) Leucine rich repeat neuronal 2 {ECO:0000313|Ensembl:ENSGGOP00000006261} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRN2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRLLVAPLLLAWVAGATAAVPVVPWHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFL
TAVPPALPAGTQTLLLQSNSIVHVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLL
SLHLEENQLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAI
DSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLE
SLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPN
LQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVREVPFREMTDHC
LPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVSPAGLRLTPAHAGRRYRVYPEG
TLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEGQGLELRVQETHPYH
ILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHSYNITRLLQATEYWACLQVA
FADAHTQLACVWARTKEATSCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRKGVG
GRRPLPPAWAFWGWSAPSVRVVSAPLVLPWNPGKKLPRSSEGKTLSPPLSQNS
Download sequence
Identical sequences G3QU65
ENSGGOP00000006261 XP_004028278.1.27298 XP_004028281.1.27298 XP_004028282.1.27298 ENSGGOP00000006261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]