SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QUJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QUJ2
Domain Number 1 Region: 104-283
Classification Level Classification E-value
Superfamily EF-hand 7.89e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QUJ2
Sequence length 285
Comment (tr|G3QUJ2|G3QUJ2_GORGO) Potassium voltage-gated channel interacting protein 2 {ECO:0000313|Ensembl:ENSGGOP00000006396} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=KCNIP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRV
FRFLGDSSLPSALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDF
VAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
REHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2I3RU08 G3QUJ2
ENSP00000420040 9606.ENSP00000420040 NP_055406.2.87134 NP_055406.2.92137 XP_003825554.1.60992 XP_004050045.1.27298 XP_016774669.1.37143 ENSGGOP00000006396 ENSP00000420040 ENSP00000359063 ENSGGOP00000006396 gi|21361460|ref|NP_055406.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]