SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3QW14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QW14
Domain Number 1 Region: 30-512
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-183
Family ALDH-like 0.0000000000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QW14
Sequence length 517
Comment (tr|G3QW14|G3QW14_GORGO) Aldehyde dehydrogenase 2 family (mitochondrial) {ECO:0000313|Ensembl:ENSGGOP00000006955} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ALDH2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAAQAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVLDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences G3QW14
XP_004053951.1.27298 ENSGGOP00000006955 ENSGGOP00000006955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]