SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3R5J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R5J1
Domain Number 1 Region: 214-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0074
Further Details:      
 
Weak hits

Sequence:  G3R5J1
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.00045
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 278-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.0534
Family Fibronectin type I module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R5J1
Sequence length 325
Comment (tr|G3R5J1|G3R5J1_GORGO) von Willebrand factor C domain containing 2 {ECO:0000313|Ensembl:ENSGGOP00000010568} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=VWC2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVN
ELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQG
EALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences A0A096NDN1 A0A1D5QZI0 A0A2K5I9Y2 A0A2K5KMW7 A0A2K6CKY0 G3R5J1 H2QUK4
ENSPTRP00000032775 9598.ENSPTRP00000032775 XP_004045480.1.27298 XP_008961142.1.60992 XP_009441076.1.37143 XP_011757686.1.29376 XP_011802955.1.43180 XP_011920873.1.92194 XP_014989050.1.72884 ENSPANP00000010978 ENSPTRP00000032775 ENSGGOP00000010568 ENSGGOP00000010568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]