SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RBM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RBM2
Domain Number 1 Region: 35-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000118
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 2 Region: 173-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RBM2
Sequence length 272
Comment (tr|G3RBM2|G3RBM2_GORGO) Low density lipoprotein receptor class A domain containing 2 {ECO:0000313|Ensembl:ENSGGOP00000012883} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LDLRAD2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLLLRSHAASRRFYFVAP
DTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPP
GAPRPLGSPLCGLTIPVPVASSGPFLGLRLVTRGRKPRVDFVGEVTSFRLGPCGAYFRCQ
NGRCIPSSLVCDPWGMDNRGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRPPTPSPAL
GSAGSLRIAAERSSPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences G3RBM2
ENSGGOP00000012883 XP_004024899.1.27298 ENSGGOP00000012883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]