SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3REZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3REZ1
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 1.07e-48
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000118
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3REZ1
Sequence length 635
Comment (tr|G3REZ1|G3REZ1_GORGO) Leucine rich repeat and fibronectin type III domain containing 4 {ECO:0000313|Ensembl:ENSGGOP00000014142} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRFN4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAPPLLXXLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPV
NLQHLILSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPTPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEA
TARVELRVLALPHGGNTSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRL
GGAWARRSHSVHGGLLGAGCRGVGGSAERLEESVV
Download sequence
Identical sequences G3REZ1
ENSGGOP00000014142 ENSGGOP00000014142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]