SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RF27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RF27
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily FKBP-like 1e-33
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000391
Family Calbindin D9K 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RF27
Sequence length 211
Comment (tr|G3RF27|G3RF27_GORGO) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FKBP14 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences A0A090N7V8 G3RF27 H2QUC7 Q5R941 Q9NWM8
ENSPTRP00000032523 NP_060416.1.87134 NP_060416.1.92137 XP_004045292.1.27298 XP_519022.2.37143 ENSP00000222803 ENSGGOP00000014183 ENSP00000222803 9598.ENSPTRP00000032523 9606.ENSP00000222803 ENSGGOP00000014183 ENSPTRP00000032523 ENSP00000222803 gi|8923659|ref|NP_060416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]