SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RGM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RGM3
Domain Number 1 Region: 681-865
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-25
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-23
Family I set domains 0.0052
Further Details:      
 
Domain Number 3 Region: 450-536
Classification Level Classification E-value
Superfamily Immunoglobulin 9.31e-23
Family I set domains 0.006
Further Details:      
 
Domain Number 4 Region: 168-262
Classification Level Classification E-value
Superfamily Immunoglobulin 9.46e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 552-655
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-21
Family Fibronectin type III 0.000025
Further Details:      
 
Domain Number 6 Region: 340-441
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.044
Further Details:      
 
Domain Number 7 Region: 64-163
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-17
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RGM3
Sequence length 1380
Comment (tr|G3RGM3|G3RGM3_GORGO) Roundabout guidance receptor 3 {ECO:0000313|Ensembl:ENSGGOP00000014773} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ROBO3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSSVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVG
EPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPHLRWRKEDGELPT
GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPMGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSIGEATWSGWLKMRE
DWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQTEAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPAQLVQGFRVSWRVAGPEGGSWTMLD
LQSRSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNQSAAGWARSAMLRGLVPGLL
YRTLVAAATRAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAA
CGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYS
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLN
WPEALPPPPPSCELSCLEGPEEELEGSSEQEEWCPPMPERSHLTEPSSSGGCLVTPSRRE
TPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQPMLGIREG
RPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRGLHPDE
EAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRIRSQSQRPGQKRREEPR
Download sequence
Identical sequences G3RGM3
ENSGGOP00000014773 XP_004052399.1.27298 ENSGGOP00000014773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]