SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RKU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RKU3
Domain Number 1 Region: 648-709
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000965
Family ATI-like 0.097
Further Details:      
 
Domain Number 2 Region: 294-348
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000262
Family BSTI 0.041
Further Details:      
 
Domain Number 3 Region: 772-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000736
Family ATI-like 0.019
Further Details:      
 
Domain Number 4 Region: 1398-1454
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000311
Family ATI-like 0.07
Further Details:      
 
Domain Number 5 Region: 1770-1850
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RKU3
Sequence length 2013
Comment (tr|G3RKU3|G3RKU3_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000016375} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MIPARVAGVLLALALILPGTLCAEGTRGRSSMARCSLFGNDFVNTFDGSMYSFAGYCSYL
LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERVSPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPAFLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YKQCVSPCARTCQSLHVNEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG
ASLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTLRLPGLHNSLVKLKHGGGVAMDGQDVQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ
CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
LRAEGLECAKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE
TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYMFPGECQYVLVQDYCGS
NPGTFRILVGNEGCSHPSVKCKKRVTILVEGGEIELFDGEANVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWRVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLFVRICM
DEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEETC
GCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQDLEVILHNGPCSPGARQG
CMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEVRFNHLGHIFT
FTPQNNEFQLQLSPKTFASKMYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPG
QTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQERVCEVIASY
AHLCRTNGVCIDWRTPDFCAMSCPPSLVYNHCEHGCPRHCDGNVSSCGDHPSEGCFCPPN
KVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSGRKVNCTTQPCPTAK
APTCGLCEVAHLRQNADQCCPEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTC
ACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVNSTVSCPLGYLASTATNDCGC
TTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDVVMGLRVAQCSQKPCEDSCRSG
FTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQWASPENPCLISECVRVKEEV
FIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERMEACMLNGTVIGPGKTVMIDVC
TTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGECCGRCLPTACTIQLRGGQIMT
LKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCE
EPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTE
PMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Download sequence
Identical sequences G3RKU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]