SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RKU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RKU8
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000154
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RKU8
Sequence length 355
Comment (tr|G3RKU8|G3RKU8_GORGO) VPS37C, ESCRT-I subunit {ECO:0000313|Ensembl:ENSGGOP00000016380} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=VPS37C OC=Catarrhini; Hominidae; Gorilla.
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPAR
PVPQRTPPVVEEQPQPPSAMPPYPLSYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQPGPRGAAGYSWSPQRSTPPRPGYPRTPTGASGPGYPLGGGRVPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences G3RKU8
ENSGGOP00000016380 ENSGGOP00000016380 XP_018893156.1.27298 XP_018893157.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]