SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RPG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RPG3
Domain Number 1 Region: 11-125
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.92e-42
Family MHC antigen-recognition domain 0.00000391
Further Details:      
 
Domain Number 2 Region: 125-221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-29
Family C1 set domains (antibody constant domain-like) 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RPG3
Sequence length 261
Comment (tr|G3RPG3|G3RPG3_GORGO) Major histocompatibility complex, class II, DQ beta 1 {ECO:0000313|Ensembl:ENSGGOP00000017683} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HLA-DQB1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSWKKALQIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVVQFKAMCYFTNGTERVRYVT
RYIYNREESARFDSDVGVYRAVTPQGRPDAEYWNSHKDILESTRAELDTVCRNNYEVAFR
GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRQRSQKGLLH
Download sequence
Identical sequences G3RPG3
XP_004043821.1.27298 ENSGGOP00000017683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]