SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RQZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RQZ9
Domain Number 1 Region: 91-137,176-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000447
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3RQZ9
Sequence length 650
Comment (tr|G3RQZ9|G3RQZ9_GORGO) Lipolysis stimulated lipoprotein receptor {ECO:0000313|Ensembl:ENSGGOP00000018223} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LSR OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGL
GSHPAAPGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPT
QPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQ
GNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLG
RTSGVAELLPGFQAGPMEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD
KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDV
DRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP
GPPNGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQA
GGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSSGGRRSRAYMPPRSRSRDDLYDQDD
SRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKG
SEERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV
Download sequence
Identical sequences G3RQZ9
XP_004060555.1.27298 ENSGGOP00000000755 ENSGGOP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]