SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RTA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RTA8
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 7.85e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 423-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 337-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-18
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 5 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 385-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  G3RTA8
Domain Number - Region: 160-255
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0863
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RTA8
Sequence length 609
Comment (tr|G3RTA8|G3RTA8_GORGO) Myoneurin {ECO:0000313|Ensembl:ENSGGOP00000019033} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MYNN OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTK
KKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINNSELELTSVV
ENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSREELDQRYSKAK
PMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCE
LCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCG
QRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFI
SSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQ
DSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEP
QLIFLQQLY
Download sequence
Identical sequences G3RTA8
ENSGGOP00000019033 ENSGGOP00000019033 XP_004038031.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]