SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3RTW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RTW6
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3RTW6
Sequence length 300
Comment (tr|G3RTW6|G3RTW6_GORGO) Pleckstrin homology domain containing A3 {ECO:0000313|Ensembl:ENSGGOP00000019243} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PLEKHA3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
Download sequence
Identical sequences G1R2P1 G3RTW6 H2QJ23 Q9HB20
ENSGGOP00000012663 ENSP00000234453 ENSNLEP00000007463 ENSP00000234453 NP_061964.3.87134 NP_061964.3.92137 XP_003253832.1.23891 XP_003815558.1.60992 XP_004032918.1.27298 XP_515943.2.37143 ENSGGOP00000019243 gi|54792084|ref|NP_061964.3| ENSP00000234453 9598.ENSPTRP00000021689 9606.ENSP00000234453 ENSPTRP00000021689 ENSNLEP00000007463 ENSPTRP00000021689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]