SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3S7N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S7N6
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.35e-58
Family MHC antigen-recognition domain 0.00000000707
Further Details:      
 
Domain Number 2 Region: 207-294
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-21
Family C1 set domains (antibody constant domain-like) 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3S7N6
Sequence length 327
Comment (tr|G3S7N6|G3S7N6_GORGO) CD1a molecule {ECO:0000313|Ensembl:ENSGGOP00000024095} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CD1A OC=Catarrhini; Hominidae; Gorilla.
Sequence
MLFLLLPLLAVLPGDGNADGLKEPLSFRVIWIESFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLWPWSRGNFSNEEWKELETLFRIRIIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNSSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVRHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
Download sequence
Identical sequences G3S7N6
XP_004027071.1.27298 ENSGGOP00000024095 ENSGGOP00000024095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]