SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3S9R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3S9R8
Domain Number 1 Region: 594-849
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 293-523
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 21-216
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-38
Family YWTD domain 0.0000092
Further Details:      
 
Domain Number 4 Region: 896-1153
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-37
Family YWTD domain 0.0000779
Further Details:      
 
Domain Number 5 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1246-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1206-1244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 549-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 852-899
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 248-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1163-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3S9R8
Sequence length 1564
Comment (tr|G3S9R8|G3S9R8_GORGO) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRP5 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGRAVPGCSIPGLCILLLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQT
GAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRA
IALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAK
LSFIHRANLDGSMARGATESDGPLASLTEKWPHGLCAMAYACNPSTLGGRGGQITRSGDR
DHPVHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTD
LRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLV
NTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMG
LMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVIN
VDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGL
KAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTS
RAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEH
VVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPT
KGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESS
NMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMD
ILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFS
QKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPF
VLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLHGDRDKPRA
IIVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDA
DLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRI
QGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLL
TCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCV
DLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCE
ITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTP
HVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKA
TLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSD
YSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPC
TDSS
Download sequence
Identical sequences G3S9R8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]