SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3SHL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SHL5
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-18
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SHL5
Sequence length 301
Comment (tr|G3SHL5|G3SHL5_GORGO) Hepatitis A virus cellular receptor 2 {ECO:0000313|Ensembl:ENSGGOP00000027604} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HAVCR2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MFSHLPFDCVLLLLLLLLTRSSEVEYRVEVGQNAYLPCFYTPAAPGNLVPVCWGKGVCPV
FECGNVVLRTDERDVNYRKSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSGLANELWDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSGQQPSQPFGCRFAI
P
Download sequence
Identical sequences G3SHL5
ENSGGOP00000027604 ENSGGOP00000020592 XP_004042941.1.27298 XP_018883770.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]