SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3SKJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SKJ6
Domain Number 1 Region: 28-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0055
Further Details:      
 
Domain Number 2 Region: 140-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000139
Family I set domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3SKJ6
Sequence length 431
Comment (tr|G3SKJ6|G3SKJ6_GORGO) Immunoglobulin superfamily member 11 {ECO:0000313|Ensembl:ENSGGOP00000028639} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=IGSF11 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTSQRSPLAPLLLLSLHGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWM
VTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQC
LVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEK
LDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNI
GLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFH
TEISSSDNNTLTSSNTYNSRYWSNNPKVHRNTESVNHFSDLGQSFSFHSGNANIPSIYAN
GTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVM
VPAQSRAGSLV
Download sequence
Identical sequences A0A2I3TMP2 G3SKJ6 H2P9N5
ENSGGOP00000028639 ENSPTRP00000056670 XP_002813306.1.23681 XP_018880342.1.27298 ENSPPYP00000015121 ENSPTRP00000056670 ENSGGOP00000028639 ENSPPYP00000015121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]