SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3STX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3STX1
Domain Number 1 Region: 523-553,657-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000122
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3STX1
Sequence length 788
Comment (tr|G3STX1|G3STX1_LOXAF) Anion transporter/exchanger protein 9 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SLC26A9 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MNQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGKKLRDAFRCSSAKIKTVVFGLFPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMEAARLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYVFGLTVPSYAGPGAIVFT
FIDICKNLPNTNMASLIFALISGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLSPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKNKLDCCVWVVSFLASFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVRETAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKKQEMGRKMPTQHKKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQKPTNGASVSYITFSPDTSSGAHCELPASAESPSDTLASVPPFVTFH
TLILDMSGVSFVDLMGIKALAKLGSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGGLER
SHIFPSIHDAVLFAQAGTRDVAPGHSFQGAPVDPELSLYDLEEDSPSYWNLEQEMFGSMF
HTETLTAL
Download sequence
Identical sequences G3STX1
ENSLAFP00000003551 ENSLAFP00000003551 XP_003410315.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]