SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3SUS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3SUS6
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00798
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SUS6
Sequence length 265
Comment (tr|G3SUS6|G3SUS6_LOXAF) Aph-1 homolog A, gamma-secretase subunit {ECO:0000313|Ensembl:ENSLAFP00000003931} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=APH1A OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSNARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
HSLSCRRQEDSRVMVYSALRIPPED
Download sequence
Identical sequences G3SUS6
XP_003409547.1.64505 ENSLAFP00000003931 ENSLAFP00000003931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]