SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3TUI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TUI8
Domain Number 1 Region: 707-836,901-967
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.79e-39
Family Hemopexin-like domain 0.00086
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000288
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000889
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TUI8
Sequence length 967
Comment (tr|G3TUI8|G3TUI8_LOXAF) Proteoglycan 4 {ECO:0000313|Ensembl:ENSLAFP00000019246} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=PRG4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MKWKILPIYLLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDAACNCDYNCQYYMECCPDF
KKVCTVELSCKGRCFESFRRGRECDCDSECKKFGKCCPDYNSFCEKAHNPTSPPSSKTTP
PVPAASLNIRSATKRSPKSPNKTEKVIESQKITEEHYVSENQESSSSSSSSTRKIKSSQN
SAANSELKKKPKVKNNKKKKTPKKRPAPELPVVEEAGSGLDSDFKLAPTTYISTTQSNKV
TTPPKITSAKPINPKPSLLPNPNTSAVKVTSKETPSTASKETTAETEKTGTTNKQILTST
EETTSAKEIQSTEKTSAPTSEVPAKPTPKGETTTKAPSLTTTKEPTPTTTKESVLTIPKE
SVPTTPKXLSPTNPMTPTPTIPKVPVTTTPENPATTSAKEPAPTIPEEPASTIPKDLTPT
IPEEPTPATPETPAPTTSESSTLTITMEPPSTPTIPAKPTPELPAEPTSKSTEDSPKELA
VPITKAPEVAKPEMTTAPEITTAAPKMTTKKTTTTTEEKTTESKITSTTMQGTTITTEDT
TLAKTTLKATTTPQITTTTKKAMTTTEIKKPEETTAIPKDTATNSEVTTPKPQKPTKAPK
KPTSTKKPKTTPKVRKPKIRPTPSKMTTTMPELSPTSEATTSPNKAPNTEIIWTNPKNED
IGAAEGEKPHMILRPPVLRPTVISGIDSLVRPHQGISVNLMFSDETNLCNGIPVDGLTTL
RNGTLVAFRGHYFWMLSPFRPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYW
RFTNDIKDAGYPKQIVKGFGGLNGKIVAALSIARYKNRPESVYFFKRGGSVQQYTYKQEP
VQKCTGRRPAINYPVYREMIQIRRRRFERAIGPSQTHTIRIHYSPVRVTYQDKDFLHNEV
PVSTLWRGLPAVVTSAISLPNIRKPDGYDYYTFSKDQYYNIDVPSRTARAITTRSGQTLS
KVWYNCP
Download sequence
Identical sequences G3TUI8
ENSLAFP00000019246 ENSLAFP00000019246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]