SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3TWI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3TWI7
Domain Number 1 Region: 339-370,515-588
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TWI7
Sequence length 745
Comment (tr|G3TWI7|G3TWI7_LOXAF) Solute carrier family 26 member 8 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=SLC26A8 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
QLSMGVLGFGFIATYLPESVINAYLAATALHIMLSQLTCILGIVISFHAGPVAFFYNIIN
YCLSLPKANSTSILLFLTAVVALRINKCIKISFNRYPIEFPMEFLLIVGFTLIANKLSMA
TETSKTLVEMIPYSFLFPVIPDMDILSKVILQAISLALVSSSLLVFLGKKIAAVHNYRVN
SNQDLIAIGLCNVISSFFRCCVFTAAIARTVIQDKSGGRQQFASLVGAGVMLLLMVKVGH
FFYQLPNAVLAGVILSNVTPYLGTISNLPHLWRQDQYDCVIWLVTFSSAIFLGLDFGLLL
SVAFAFFIIAVRSHRAKIYLLGQIPNTNIYRSISDYREITNIPGVKIFQCCNSITFVNVY
QLKRRLLNEIDMIRVRLKEEEVFGLFTRCAHSGHTSREAERGCRCYCNCDEPEPPPRIAY
TERFERKLGHSSSTIHLVSCARFESVTTNQSTSDEQVPYTVSSTSQRNQGRNLEEEEKVW
VPNNPLRNSSPPLPDTTESQGRSRSLLPYSDVSLLPTTHTIILDFSMVHFVDSQASVILR
QMCNAFQNANILVLIAGCHSSVIRALERNDFFDTGITKAQLFLTLHDAVLFALSRKIPDS
SELSVDESETVIQETFSEKDKKNEEPGYHMNNSNIEIPKNTNPGFRALIREPEVVEESEL
EPTLESEQENELDLDLDLDLELEPESEPVPKSRPRVQTHSPQYRRSPYPSSQPQTQPWTR
SVERRHQHMDLHSSKGNDTKDPWEE
Download sequence
Identical sequences G3TWI7
ENSLAFP00000019945 ENSLAFP00000004294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]