SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UDA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UDA5
Domain Number 1 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 18-277
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-55
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 327-566
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 931-1191
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-35
Family YWTD domain 0.0000572
Further Details:      
 
Domain Number 5 Region: 885-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000101
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1322-1360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 583-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000097
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1243-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 280-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1200-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000033
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UDA5
Sequence length 1610
Comment (tr|G3UDA5|G3UDA5_LOXAF) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LRP6 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
TFLSFLLTYFSFFVLAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHG
LIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSN
LDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTEIYW
PNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWN
THSILACNKYTGKGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVK
PYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIA
IDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVL
VNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDF
VYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCL
YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEA
SALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADT
GTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERT
TLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDY
IYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLC
LAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSL
RNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQSFTVVVSSVPNQNLEIQPYDLSIDIY
SRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNRPVLRYMYFTNLQERSPKI
ERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSN
ILQPVGLTVFENWLYWIDKQQQMIEKIDMMGREGRTKVQARIAQLSDIHAVKELNLHEYR
QHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDC
IPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCE
VLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVT
IFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLAYVPHPSSLSGSLPGMSRGK
SMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFG
YSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSMATAKGYTSDLNYD
SEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G3UDA5
ENSLAFP00000025813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]