SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UER6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UER6
Domain Number 1 Region: 223-605
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.26e-72
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.003
Further Details:      
 
Domain Number 2 Region: 2-211
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.27e-36
Family Lipovitellin-phosvitin complex, superhelical domain 0.0019
Further Details:      
 
Weak hits

Sequence:  G3UER6
Domain Number - Region: 969-1021
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0164
Family MLTA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UER6
Sequence length 1769
Comment (tr|G3UER6|G3UER6_LOXAF) Apolipoprotein B {ECO:0000313|Ensembl:ENSLAFP00000026324} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=APOB OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
IITYLMALIPEPPEERVREIFNTAKEQQSRATLYALSHVVNNYHKIAPQRTQILLDIEDY
LLAQIHNDCTGDKDHTYLILRVIGNMGRTMEQVSPRLSSSVLKCIESTEPSLLIQKAAIQ
ALRKMGSNEEIQEALLQAFFDGASPVDKRLAAYLMLMRGPSQADVNRIVQLLPWEQNDQV
KNFVASHIANILNSEELYIQDLKTLLEEALKGSQLPTIMDFKKFSRNYHFSKSVSLLSLD
PISAKIEGNLIFDPNNYLPRESMLKTTLTVFGFSPADLFEIGLEGKGFEPTLEALFGKQG
FFPDSVNKALYWVDGRVPDQVSRVLVDHFGYTKDDKHAQDMVNGIMLNVEKLIKDLKSKE
VPEARAYLRMLGEELGFVKLNDLQFLGRLLLSGIHILQGVPRMIGEAISKGSKNDLFLHY
IFMDTAFELPTGAGLQLQVSSSGVITPGMKAGVKLEVASMQAELVAKPSVSVEFVTNVGI
IIPDFARSGVQMNTNFFHESGLEARVALKAGQLKFIVPSPKRPVKLFSGSNTLHLVSTTK
TDMILPLIENRQTWSNCKPFFVGLNYCTSGAYTNASSTDSASYYPLTGETRFELELQPTG
EVEQYSASATYELQREGTVSSVLLFFIAFSGLEQAKATMMFKYNRQSMTLSSGIQIPDFS
VDLGTVLRVSDDSAKDKKSYKLTLDIQNNKITEVTLTGHVSYDSKEEGKIKSVISIPHWQ
AEARSEILARWSHTKLFLQMDSSATAYGSMISKKVAWRYDEEKMEFEWNAGTNVDTKKVA
SNFPLDLSDVSRSLHTYANSLLDHRVPQTDMTFRHMGSKLIAATNTWLQEAPRNLPYAQT
LQDHLSGLEEMNIQKMGLPDFHIPENLFLKSDGRIKYTLNKNSVKIEIPLPFGGKSSKDL
KILETVQTPALDLKSVGFHLPSQEFRIPSFTIPKFYPLRVPLLGVLDLSTNVYSNVYNWS
ASYTGGNTSTDHLSLKAQYYMKASSVVDLFSYSVQGSGETTYNHRNTFTLSYDGSLHHKF
LDSNIKLSHVEKSGNSPASTCSLIFEAASAWGPQMSALVHLDSKKKQHLYIKEVKVDGQF
RASSFYTKGSFGLSYQRDLNTGQLSGESNLRFNSSYLQGTNQVTGSYKDGAVSFTSTSDL
QGGLLKNTASLKYENYELTLKSDTTGKYKDFATSNKVDVTFSKQNALLRSEYQADYKALR
FFTLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGMSTSATTNFRYSPLVLENE
LNAGLGLSGASVKLTTSGRFREHNAKLNLDGKATLTEVSLGSAYQAIILGVDSKNIFSFK
INQEGLKLSNDMMGSYAEMKLDYTNSLNIAGLSLDFASKLDNVYSSDKFYKQNFNLHLQP
YSLVTTLNNDLKYKALDLTNSGRLRLEPLKLNVGGNIKGTYQNNEIKHIYTISYADLSAS
YKADTVAKVQGVEFNHRLNTDFAGLASAIDISTNYNSDSLHFSNVFHSTMAPFTMTIDAH
TNGNGKLGLWGEHLGQLYSKFLLKAEPLALTFSHDYKGSTSHHLVYKTSIDTALDHKVSA
LLTPTEQTGTWKLKTQLNKNEYNQDFDAYNTKDKVGIELSGRGLADITMLDSPIEVPFLL
SEPVNVIDALGMRDVSDQPQEFTIVASVKYDKNQNVHIINLPFLKILPEYFERNRIAIIA
VLESMQRELKHININQFARKYKAALDKVPKQVTDYLNAFNWEARVTNAKEKLTAFTKNYK
ITANDLQIMLDNAKINLNEKLSQLQTYVI
Download sequence
Identical sequences G3UER6
ENSLAFP00000026324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]