SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UKG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UKG5
Domain Number 1 Region: 643-789
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 968-1068
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-29
Family Ras-binding domain, RBD 0.0013
Further Details:      
 
Domain Number 3 Region: 220-353
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-22
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 
Domain Number 4 Region: 8-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.0094
Further Details:      
 
Domain Number 5 Region: 913-982
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000698
Family First domain of FERM 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UKG5
Sequence length 1338
Comment (tr|G3UKG5|G3UKG5_LOXAF) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSLAFP00000028324} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=RGS12 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MHRAGELGWRRTRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVN
EINVKKASHEDVVKLIGKCSGVLHMVIGEGLGHLESCSSDEEVGFYEGKGWFKPKLDSKA
LGINRAERVVEEVQSGGIFSMIFETPSLCASPSEPLKPKQRCLSESAAVRLDTGHETVNN
PNANMLYKEEIAKVINDDSVFSIGLENHDDFGLDASILNVAMVVGYLGSIELPSTSSNLE
YDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLCTDKAGVVAEYPAEKLAFSALCPDD
RRFFGLVTMQTNDDGSLAQDEEGVLRTSCHVFMVDPDLFNHKIHQGIARRFGFECTADPD
TNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDAGRPPEQQHQQQQLTAASG
NFNQEREERPRPRGRPWVGGSSRHAPTSGAGDLHKHLGPDPTWSCRPAALRSSVPPFQAE
HVGTGCFHQRWLPVHVLQEWQCGHASDQDYTDSTDGWSSVNCGTLPPPMSKIPADRYRVE
GSFAQPPLSAQKSEWSRKAFGVPNIFGPHRNVRKTKEDKKGSKFGRGIGLIQTSQRTSRR
SFGRSKRFSITRSLDDLESATVSDGELDGGDLKDCVSNHSLSSNASLPSVQSCRHLRARR
VASWAVSFERLLQDPVGVKYFSDFLRKEFSEENILFWQACERFHHVPAHDKQELSYRARE
IFSKFLCSKATTPVNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLY
QECILAEVEGRSLPDAQQVPSSPASKHSVGSDHSNVSTPKKLSGKSKSGRSLNEDLGEED
GEKKRKGAFFSWSRNRSTGRSQKKKEHSDPSHDPLHANGGLCRRESRGSTSSAGSLDLTE
AGRSPAPEQEKAKHCRVHLPDGTVCAVPVRVGASIKEALAGLCERHGINGAAVDLFLVGG
DKPLVLQQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGL
DLRDLAVRLSGEKELLDLGAPISSLDGQRVVLEEKDPSRGKASTDKQKGASGKHSIAVNS
SSRSHAATGEQRTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEE
FFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTGLALSTPAAAKGISKRLGKSHS
QDSALPPGERWEAQDRGESSAASPSSASSQPRSPAATSPGQKPPAGPLPSPWAPHPAAQE
GASKTWRRQPREVEGVQTLEEDPTADLTLVGEGDISSPNSSLLPPLPTPPASAHHAPPTP
LLDTQDTPGLQRPGTSRV
Download sequence
Identical sequences G3UKG5
ENSLAFP00000028324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]