SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UPE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UPE6
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-79
Family Calponin-homology domain, CH-domain 0.0000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3UPE6
Sequence length 255
Comment (tr|G3UPE6|G3UPE6_MELGA) Filamin B {ECO:0000313|Ensembl:ENSMGAP00000017441} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FLNB OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
DAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQKRMYRKYHQRP
TFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWED
EGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWETWD
PSKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKP
KLNPKKVRAYGPGLE
Download sequence
Identical sequences G3UPE6
ENSMGAP00000017441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]