SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UY72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UY72
Domain Number 1 Region: 40-279
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-58
Family ALDH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UY72
Sequence length 321
Comment (tr|G3UY72|G3UY72_MOUSE) Alpha-aminoadipic semialdehyde dehydrogenase {ECO:0000313|Ensembl:ENSMUSP00000133970} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh7a1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
RVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGR
GEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFR
EKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMW
NPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNL
LPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEGKACWSLEETMPLLLSRTRTS
AWLFRQFCLPPWEQLGKGVPL
Download sequence
Identical sequences G3UY72
ENSMUSP00000133970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]