SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3UYR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UYR8
Domain Number 1 Region: 52-463
Classification Level Classification E-value
Superfamily ALDH-like 1.02e-109
Family ALDH-like 0.00000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UYR8
Sequence length 475
Comment (tr|G3UYR8|G3UYR8_MOUSE) Alpha-aminoadipic semialdehyde dehydrogenase {ECO:0000313|Ensembl:ENSMUSP00000134192} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh7a1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
FREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIE
MWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLED
NLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLVMDHPGNYVEPTIVTGLAHDAPIV
HQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVN
IPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ
Download sequence
Identical sequences G3UYR8
ENSMUSP00000134192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]