SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3V9H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3V9H1
Domain Number 1 Region: 691-838
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-30
Family Ras-binding domain, RBD 0.00084
Further Details:      
 
Domain Number 3 Region: 227-362
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-24
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 
Domain Number 4 Region: 9-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-16
Family Ras-binding domain, RBD 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3V9H1
Sequence length 1387
Comment (tr|G3V9H1|G3V9H1_RAT) Regulator of G-protein-signaling 12 {ECO:0000313|Ensembl:ENSRNOP00000047497} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_36076 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MYRAGEPGKRQSGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAG
DQILAINEINVKKASHEDVVKLIGKCSGVLRMVISEGSSHVEPSSSDEEGGLCEGKGWLR
PKLDSKALGINRAERVVEEVQSGGIFNMIFESPSLCASGSEPLKLKQRSLSESAALRLDV
GQDSLCTPHPSMLSKEEISKVINDDSVFTVGLDNHDDFGLDASILNVAMVVGYLGSIELP
STSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDCVQLVTDRAGVVAEYPAEKLAF
SAVCPDDRRFFGLVTMQTNDDGCLAQEDEGALRTSCHVFMVDPDLFHHKIHQGIARRFGF
ACTADPDTSGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFLDGDADAHQNNSTSSN
SDSGIGNFNQEEKSNRVLVVDLGGGSSRHGQGSSPGWESVSGRGSQPWSAPWNGTFCHDS
EAGSPLETSPNTDRFWDLTKHSGPVFHMEVPPATLRSSIPPSKRGATGSSCGFNQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQAPLSTQKR
DWSRKAFGMQNLFGPHRNVRKTKEDKKSSKLGRGVALAQTSQRTSARRSFGRSRRFSLTR
SLDDLESATVSDGELTGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACECFSHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVEGRT
LPDSQQVPSSPASKHSISSDHSNVSTPKKLSGKSKSGRSLNEDVGEEDSEKKRKGAFFSW
SRSRSTGRSQKKKDHGDHAHDALHANGGLCRRESQGSVSSAGSLDLSEACRTSALERDKA
AKHCCVHLPDGTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILATRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSG
EKEPLDLGAPISSLDGQRVILEERDPSRGKVSTEKQKGAPVKQSSAVNSSPRNHSAMGEE
RTLGKSNSIKIRGENGKSARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPGSSELALSSPPPVKGFSKRAVTSHGQEGAVQTEESY
SDSPATSPASAQSPCSAYSPGSAHSPGSAHSPGSAHSTPGPPGTAQPGEKPTKPSCISTV
QEGTTQAWRRLSPELEAGGIQTVEEEQVADLTLMGEGDISSPNSTLLPPPPLPQDTPGPT
RPGTSRF
Download sequence
Identical sequences G3V9H1
10116.ENSRNOP00000047497 ENSRNOP00000061980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]