SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3VNB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VNB8
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-56
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 180-419
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-50
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 783-1038
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-39
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-28
Family YWTD domain 0.0000961
Further Details:      
 
Domain Number 5 Region: 1169-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1131-1166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 7 Region: 1090-1130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000519
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000428
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1049-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3VNB8
Sequence length 1449
Comment (tr|G3VNB8|G3VNB8_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000004673} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LRP5 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDI
QVLSQDRQPYFHTPCEEDNGGCSHLCLLSPREPFYTCACPTGVQLEDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIILQIDDIRHAIAIDYDPVERYVYWTDDEVRAIRRAYLDG
SGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGESPKIECAHLDGQARRVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTRRRTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVKADRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCGEKNGGCSHLCFFTPHATKCGCPIGLELLSDLQTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAYM
NGSSVEHVIQFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPR
SLALDPTKGYLYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERIIIADDLPHPFGLTQYSDYIYWTDWNLHSIERANKLTGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGQLCLAVPNGYRCACATHYSLDPNHRNCSSP
TTFLLFSQKCAISRMIPDDQQSPDVVLPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRAR
DDGSQPFIVTSASQGQEKQPHDLSIDVYSHTLYWTCEATNTVNVHRLSGEAIGVVLRGDR
DRPRAIAVNAERGYMYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNHLGKL
FWVDADLKRIESCDLSGANRVTLEDSNIVQPVGLTVLGDHLYWIDRQQQMIERVEKTGGY
KRTRIQGRISHLTGIHAVEEVDMEEFAAHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVL
LQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDHSDEADCPVCSAAQFQCE
KGQCIDLRWRCNGEIDCQDKSDEADCDAICLPNQFRCASGQCILIKQQCDSFPDCMDGSD
ELLCEITKPPSDDPPSHSNAIGPVIGIILSLFVMGGMYFVCQRVICQRYTGASGPFPHEY
VSGAPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSSGLPLYDRNHVTGASSSSS
SSTKATLYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSYRPYIIRGIAPPTTPCSTD
VCDSDCTTSRWKASKYYMDLNSDSDPYPPPPTPHSQYLSAEESCPPSPATERSYFHLFPP
PPSPCTDSS
Download sequence
Identical sequences G3VNB8
ENSSHAP00000004673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]