SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3WBJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WBJ6
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000556
Family VPS37 C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3WBJ6
Sequence length 348
Comment (tr|G3WBJ6|G3WBJ6_SARHA) VPS37C, ESCRT-I subunit {ECO:0000313|Ensembl:ENSSHAP00000012801} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=VPS37C OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MEELRTRTVEELEKLQDDPEEINRLVMESPEVQDLQLEREMALATNRSLAERNLEFQAPL
EISRSNLLDKYQELQKLVEKCQEQKARLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLDTFLESFASMRMLSHLRRVRVEKLQELVRKPRASKEPARPVVPPRPVIETT
TAVAEAPPAPPAAPALPATGPPYPLPYNPAPNLGVGPLAQGALPLSPCPVTTQPSYPYRG
PSGPAYAPAQPAGAALGRPWSPHSSPGPGAYPMARGPAPNPGYPQQAYFPAGGRPPYPTQ
APAYPSQPQMPNFPRQPRPSGPPQPPYPTGPALPYGFSTPQGPVWPGY
Download sequence
Identical sequences G3WBJ6
XP_012408206.1.9362 ENSSHAP00000012801 ENSSHAP00000012801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]