SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3WLX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WLX7
Domain Number 1 Region: 631-886
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-57
Family YWTD domain 0.00000295
Further Details:      
 
Domain Number 2 Region: 20-279
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 330-569
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 4 Region: 934-1193
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-39
Family YWTD domain 0.0000369
Further Details:      
 
Domain Number 5 Region: 888-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 586-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 282-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000778
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1203-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3WLX7
Sequence length 1614
Comment (tr|G3WLX7|G3WLX7_SARHA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=LRP6 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
MDRLLLALICSFKKRKKGAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFD
HGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEV
SNLDGTLRKVLFWQELDQPRAIALDPANGFMYWTDWGEVPKIERAGMDGSNRFIIINTDI
YWPNGLTLDYEEEKLYWADAKLNFIHKSNLDGTNRQAVVRGSLPHPFALTLFEDTLYWTD
WNTHSILACNKYTGEGLREVHSDIFSPMDIHAFNQQRQPNATNPCGIDNGGCSHLCLMSP
IKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRH
AIAIDYDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTD
TGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDR
VVLVNTSLGWPNGLALDYDEEKIYWGDAKTDKIEVMNADGTGRRVLVEDKIPHIFGFTLL
GDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCANENGGCSH
LCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGV
KEASALDFDVTDNRIYWTDISLKTISRAFMNGSSLEHVVEFGLDYPEGMAVDWLGKNLYW
ADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGS
ERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQY
QDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCS
HLCLAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPI
HSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGLTVVVSSVPNQNVDMQPYDLSI
DIYSRYIYWTCEATNVINVTRLDGRPVGVVLKGEQDRPRAIMVNPEKGYMYFTNLQERSP
KIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLED
SNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLLE
YRQHPCSQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGVEEPPTCSPQQFTCFTG
EIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGVLRCNGDANCQDKSDE
KNCEVLCLIDQFRCTNGQCIGKHKKCDNNVDCSDKSDELDCYPTEEPTPQATNTVGSVIG
VILTIFLFGAMYFICQRVFCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGM
SRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPGILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRITTVAAAKGYTSD
LNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G3WLX7
ENSSHAP00000016432 ENSSHAP00000016432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]