SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3X750 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X750
Domain Number 1 Region: 591-645
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000883
Family BSTI 0.011
Further Details:      
 
Domain Number 2 Region: 827-886
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000335
Family VWC domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3X750
Sequence length 1015
Comment (tr|G3X750|G3X750_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000019305} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PTTSATPVHTSSTTSVPTTSSTSVQTNSTTSAPTTSSTSVQTSSTTSTPTTSVTPVHTSS
ATSAPTTSTISVQTSSATSAPTTSATPVHTSSTTSAPTTSATPVQTSSTTSVPTMSSTSV
HTSSATSAPTTSPTSVPTSETTPSPRSTVPCSCSVSGQLHPAAGSFIYQATDLSGHCYYA
FCNPDCHVVKGTAPTCPTSMPPPTPPATTSVSQQVCSNAVPPGTVTSPLLPFSGTQGAWE
GTLSGFQPESVKGETWPMPNCSEATCQGNGVITVSPRHCPRVQKPTCANGYPAVQVTDHD
GCCSHYQCPCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFGHFRVLVENYFCDA
EDGLSCPQSIIVEYHENRVMLTRKPVHGVMTNEIIFNGEVVRPGFQKGGIAVFQVGIKMY
VSIPKLGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDQKDECRLPGGTVVASCSDMS
GHWKVTYPGQPSCHGPPPTSGEPGTSPTPREPGTLPTPCPPSPICQLILSTPFELCHVLI
PPWPYYQGCTFDQCHMPGTDMVCTALELYAALCASLGVCVDWRGHTNSTCPFTCPVGMEY
WPCGPPIPSYCYTNNSASSLPITEGCFCPRGTMLYSSSKEVCVPDCNRPGVPRPQTVWPC
LECTCEGSTQTMSCQPQACPTAPACPESGQVPVPEAMQTGQCCPSTAAACDTRYCPEPEA
CPKGSRAIQTHREAACCPTYNCTGWTACSINGTLYQPGAVVSSSLCEKCWCELPGGALSD
TFLINCETQICSTSCPVGFKYQARARQCCGECVQVACVINTSNSSAHLFYPGESWSDPGD
HCVTHECEQHRDGLVVVTTKKACPPLNCPADKALPSEDGCCLFCPPHNNRSTCAVHHQLQ
VLRQQGCSSPGPVRLAYCRGNCGDTTSAFSPEANAVEHRCSCCRELRFSLRNVTLHCKDG
SSRALTYTEVEECGCEGLQCDSPGGLGLSAVALEPSPESGLRRRVRRAPRARPLP
Download sequence
Identical sequences G3X750
ENSBTAP00000019305 ENSBTAP00000019305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]