SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3X915 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X915
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.00000000131
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3X915
Sequence length 215
Comment (tr|G3X915|G3X915_MOUSE) LysM, putative peptidoglycan-binding, domain containing 2, isoform CRA_b {ECO:0000313|EMBL:EDL26332.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_1133 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MADLSPAPALREGGPRAHRPSAPSPPPRSRSTSEPEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLSIPILSE
KPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFL
QRLDLQIKLSTQAARKLKEESRDEESPYAASLYHS
Download sequence
Identical sequences G3X915
10090.ENSMUSP00000034702 ENSMUSP00000034702 NP_081585.2.92730 ENSMUSP00000034702 ENSMUSP00000034702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]