SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4NM90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4NM90
Domain Number 1 Region: 302-337,403-477
Classification Level Classification E-value
Superfamily TPR-like 0.000000121
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4NM90
Sequence length 506
Comment (tr|G4NM90|G4NM90_CHLT4) Uncharacterized protein {ECO:0000313|EMBL:AEP34930.1} KW=Complete proteome OX=580047 OS=Chlamydia trachomatis serovar A (strain A2497). GN=CTO_0121 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MCLKLKQIQLCRTFVCLRHWMCFIGIGSLLLPTALRATERMRKEPIPLLDKQQSFWNVDP
YCLESICACFVAHRDPLSAKRLMYLFPQLSEEDVSVFARCILSSKRPEYLFSKSEEELFA
KLILPRVSLGVHRDYDLARVLVLAEPSAEEQKARYYSLYLDVLALRAYVERERLASAAHG
DPERIDLATIEAINTILFQEEGWRYPSKQEMFESRFSELAAVTDSKFGVCLGTVVLYQAV
AQRLDLSLDPVTPPGHIYLRYKDKVNIETTSGGRHLPTERYCECIKESQLKVRSQMELIG
LTFMNRGAFFLQKGEFLQASLAYEQAQSYLSDEQISDLLGITYVLLGKKAAGEALLKKSA
EKTRRGSSIYDYFQGYISPEILGVLFADSGVTYQETLEYRKKLVMLSKKYPKSGSLRLRL
ATTALELGLVKEGVQLLEESVKDAPEDLSLRLQFCKILCNRHDYVRAKYHFDQAQALLIK
EGLFSEKTSYTLLKTIGKKLSLVAPS
Download sequence
Identical sequences G4NM90
gi|385269769|ref|YP_005812929.1| gi|385269769|ref|YP_005812929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]