SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4QAW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4QAW2
Domain Number 1 Region: 65-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.26e-72
Family Phosphate binding protein-like 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G4QAW2
Sequence length 353
Comment (tr|G4QAW2|G4QAW2_TAYAM) TRAP transporter-like protein {ECO:0000313|EMBL:AEP36422.1} KW=Complete proteome OX=1008459 OS=Taylorella asinigenitalis (strain MCE3). GN=TASI_0649 OC=Alcaligenaceae; Taylorella.
Sequence
MKLFKTTSILAFVLVALAACGEKEDTNKTTSKTETTTTETKTVTQETKAPETSSDTAKSE
GLETKFVTIATGGASGPYNIIATTLADEYNKAYGVNSKTQTTGASVENANLVGGGKVEMA
FLMSDILSDAVKGQNSFKQPVETIRQMAVLYPNFVQVVTSKDSGINTLADIKGKRVSVGA
PGSGTEANARNLIEGFGMTYNDIKVDYLGYAESADALKTGKVDVAFLTSGLPNASLLELS
RSFPMKLVSVPAEKLKEIADKAPYFSSKEIPAGTYGNDEPVTTAVIRNAIIVSSKLSDDD
VYKLTKTFIEKLPNLQNSHQAIKAVDSKSAQEGMVAPIHPGAKKYYDELNAKQ
Download sequence
Identical sequences G4QAW2
WP_014111319.1.32922 gi|348589983|ref|YP_004874445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]