SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G4QNL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4QNL9
Domain Number 1 Region: 286-363
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000011
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G4QNL9
Sequence length 372
Comment (tr|G4QNL9|G4QNL9_GLANF) Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF {ECO:0000313|EMBL:AEP31577.1} KW=Complete proteome; Reference proteome OX=1085623 OS=Glaciecola nitratireducens (strain JCM 12485 / KCTC 12276 / FR1064). GN=GNIT_3483 OC=Alteromonadaceae; Glaciecola.
Sequence
MMFKRVHKWLSLAVFIQLFIWLGSGFLLGKLDMDKAAGRDTLVRNNPTSFARFYENTDDN
SGAVNTPFVSVKSLLKNYPMTSEIELSRLFDQVIYKLKINAGQHDYQASHYKLVDAISGE
LIDLSAEELAPTDKKLIYQIARFSYKDSAFGSSQTQNPNLSADQSEKMSVAGLLYPPIED
LPRERNAVWQINVDDVSQTSIYIRAQTGDVIAHVNDETRWRDLLLMLHFMDYAEEGSFNN
WFIKIFAVMTLLLSGTGAWGLYRLFSDGRIKITWFDRNKMLLVHSEKLPKAVTLSASANS
SILDALSASNIEIRSICGGGGLCGTCKFKGEPELLITAADRERLTPDELALGYRLACQHV
MKEVSNIELNQH
Download sequence
Identical sequences G4QNL9
WP_014110448.1.47640 gi|348030884|ref|YP_004873570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]