SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AJZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AJZ2
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0536
Family Molybdopterin synthase subunit MoaE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AJZ2
Sequence length 184
Comment (tr|G5AJZ2|G5AJZ2_HETGA) Tumor necrosis factor, alpha-induced protein 8-like protein 2 {ECO:0000313|EMBL:EHA97352.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10551 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MESFSSKSLALQVEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKDYTHSRPQAQRVI
KDLVKVAVKVAVLHRNGCFGPEELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVGRHLTPKSHGRIRHVFDHFSDLGLLTALYGPDFRQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences G5AJZ2
HGL_H00000357906 XP_004854074.1.39548 XP_004854075.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]