SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AK35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AK35
Domain Number 1 Region: 31-185
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.46e-46
Family Canonical RBD 0.00000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AK35
Sequence length 282
Comment (tr|G5AK35|G5AK35_HETGA) Heterogeneous nuclear ribonucleoprotein A3 {ECO:0000313|EMBL:EHA97395.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20930 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEVKPPPGRPQPDSGRCRRHRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTNCAVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKTETMEVMEDRQSGKKRGFAFATFDDHDTV
DKIVQKYHTINGHNREVKKALSKQEMQSAGSQRGCGGGSGNFMGHGGNFGGGRGNFGHGG
NFGGRGGYGGGGGCSRGSYGGVMVDIMDLEVMVGTVAVVLLQ
Download sequence
Identical sequences G5AK35
HGL_H00000416340-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]