SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AL40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AL40
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily POZ domain 1.18e-26
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-19
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Weak hits

Sequence:  G5AL40
Domain Number - Region: 638-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000509
Family Classic zinc finger, C2H2 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AL40
Sequence length 667
Comment (tr|G5AL40|G5AL40_HETGA) Zinc finger and BTB domain-containing protein 20 {ECO:0000313|EMBL:EHA97750.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03613 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKL
LLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIV
SQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIYSALYACSMQ
NGSGERSFYSGAVVSHHETALSLPRDHHMEDPNWITRIHERSQMERYMSTTPETTHCRKQ
PRPVRIQTLMGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDTDQAEGTESEPKGES
FDSGVSSSIGTEPDSVEQQFGTGATRDGQSDPTQPEQAAEAPTEGSAQPNQLETGASSPE
RSNEVEMDSTVITVSNSSDKSILQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLT
SNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLSTFTAQL
PAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRS
FSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEKSYECYICKKKFSHK
TLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVCPAKFDQIEQFNDHM
RMHVSDG
Download sequence
Identical sequences G5AL40
XP_012930733.1.39548 HGL_H00000419153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]